PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g17420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 401aa    MW: 44440.9 Da    PI: 7.9688
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g17420.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-1878125148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEde+l++ ++++G g+W+++++  g++R++k+c++rw +yl
   Vang04g17420.1  78 KGLWSPEEDEKLLRHITKHGHGCWSSVPKQAGLHRCGKSCRLRWINYL 125
                      678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-2870128IPR009057Homeodomain-like
PROSITE profilePS5129425.99973129IPR017930Myb domain
SMARTSM007171.2E-1477127IPR001005SANT/Myb domain
PfamPF002491.3E-1578125IPR001005SANT/Myb domain
SuperFamilySSF466895.85E-2280153IPR009057Homeodomain-like
CDDcd001671.49E-1281125No hitNo description
PROSITE profilePS500904.252126168IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.8E-8129154IPR009057Homeodomain-like
SMARTSM0071716130188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
LPLHFPVFNS HNLSRSHILP ITVWLSATPA DLSPTPTHKF NSRTHQLIGK VHPFGGVRSY  60
QKLQMGRHSC CYKQKLRKGL WSPEEDEKLL RHITKHGHGC WSSVPKQAGL HRCGKSCRLR  120
WINYLRPDLK RGTFSQEEEN LIIELHAVLG NSFKSDEGSF EQRASSIAPK AYEMEGSCSS  180
KINTKNDTNL IANCSNKDLF LDSYTTSCQP SDLMGNYPLQ MTDTLPTNSD SNHWFSPTAR  240
PIDINSEFTS NVMSILPPTT TSFLPSTSFC YKPSLAVPPE DISAPSFALN GPNYWEPSAS  300
NNSNGSNTSD GSREFTSSKN SVLSSWGLTE EAKWSEYLHN PMLMLAAPES LCNQIRPATH  360
LVPDNTLGSI ISGSKEQHQS QTSAIFSKDI QKLTAAFGHI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1476153581B-MYB
1h8a_C5e-147515324101MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494877.11e-170PREDICTED: transcription factor MYB86-like
TrEMBLA0A151TXE31e-178A0A151TXE3_CAJCA; Transcription factor MYB86
STRINGGLYMA03G38410.11e-134(Glycine max)
STRINGGLYMA19G41010.21e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-57myb domain protein 61